Nr 8 Jinshun Road Zhuqiao Pudong New District, Szanghaj, Chiny
Dom ProduktyPeptydy do wstrzykiwania

Peptydy budujące mięśnie CJC-1295 Bez DAC dla kulturystów

Peptydy budujące mięśnie CJC-1295 Bez DAC dla kulturystów

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

    Szczegóły Produktu:

    Miejsce pochodzenia: Shanghai
    Nazwa handlowa: FILTER
    Orzecznictwo: GMP
    Numer modelu: API

    Zapłata:

    Minimalne zamówienie: 10 fiolek
    Cena: USD 4~8 per vial
    Szczegóły pakowania: 2 mg, 5 mg / fiolka, 10 mg / fiolkę lub w razie potrzeby
    Czas dostawy: W ciągu 3 dni roboczych
    Zasady płatności: L / C, T / T, , MoneyGram, Payneer
    Możliwość Supply: 100 000 pozycji na miesiąc
    Kontakt
    Szczegółowy opis produktu
    Specyfikacja: 2mg/fiolkę Wygląd: Biały proszek
    Czas dostawy: W ciągu 3 ~ 7 dni roboczych Port: Szanghaj / Shenzhen / Hongkong
    Pakiet: Icebag, dyskretne sposoby pakowania w celach informacyjnych LimitNum: 10 fiolek
    Czystość: 99% Transportu: DHL, Fedix, HKEMS, HKEUB, TNT
    Pamięci masowej: suche, ciemne i wentylowane miejsce, (2 ~ 8 Dogree)
    High Light:

    peptides bodybuilding supplements

    ,

    human growth peptides

    CJC-1295 z przetwornikiem cyfrowo-analogowym

    Nazwa produktu: CJC1295 DAC; CJC1295 z DAC
    Alias: CJC1295 (GHRH / DAC)
    Sekwencja: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu- Gln-Asp-Ile-Leu-Ser-Arg-LysLys (maleimidopropionylo) -NH2 (kompleks powinowactwa)
    Gęstość: 1,45
    CJC-1295 z przetwornikiem cyfrowo-analogowym
    Typ: Odporne czynniki funkcyjne Klasa
    Standard: klasa medyczna
    Klasyfikacja: Brassinosteroid
    MF: C165H271N47O46
    Masa cząsteczkowa: 3649.30
    Czystość (HPLC): 98,0%
    Wygląd: biały proszek
    Pojedyncze zanieczyszczenie (HPLC): 1,0%
    Skład aminokwasów: 10% teoretycznej
    Zawartość peptydu (N%): 80% (według% N)
    Zawartość wody (Karl Fischer): 6,0%
    Zawartość octanu (HPIC): 15,0%
    Bilans masy: 95,0 ~ 105,0%

    Filtruj Bio-Tech Co., Ltd. Obszar biznesowy:

    Jako producent peptydów i sterydów jesteśmy dla OEM dla klientów, którzy mają wymagania dotyczące marek ( usługa na zamówienie).
    Usługi naszej firmy:

    1. Peptyd farmaceutyczny + peptyd do odbudowy ciała
    2. Peptyd kosmetyczny
    3. Sterodis w proszku, oleju i tabletki
    4. Usługa na zamówienie

    Który typ preferują Twoi klienci?

    Opis
    Nazwa produktu: CJC1295
    Synonimy: CJC1295; Y (d-A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrozylo-D-alanylo-L-alfa-aspartylo-L-alanylo-L-izoleucylo-L-fenyloalanylo-L-treonilo-L-glutaminylo-L-serylo- L-tyrozylo-L-arginylo-L-lizylo-L-walilo-L-leucylo-L-alanylo-L-glutaminylo-L-serylo-L-alanylo-L-arginylo-L-lizylo-L-leucylo-L- leucylo-L-glutaminylo-L-alfa-aspartylo-L-izoleucylo-L-leucylo-L-serylo-L-arginylo-N6- [3- (2,5-dihydro-2,5-diokso-1H-pirol- 1-ylo) -1-oksopropylo] -L-lizynoamid; octan CJC-1295; CJC1295 bez DAC
    CAS: 863288–34–0
    MF: C159H258N46O45
    MW: 0
    EINECS:
    Kategorie produktów: Peptydy


    Nasz proces:
    Proces kontroli jakości
    1) Zakup
    Dokładne badania rynku, zrozumienie ceny surowców i wydajności. Aby uzyskać źródło zaopatrzenia, aby w pełni zrozumieć i w pełni zagwarantować jakość zakupów surowców.


    2) Kontrola
    Cztery etapy: pobieranie próbek, wstępne przetwarzanie próbek, pomiar i przetwarzanie danych.


    3) Produkcja
    a) Każdy operator musi przeprowadzić samokontrolę produktów i dokonać odpowiednich zapisów z kontroli.
    b) Inspektorzy zatrudnieni w pełnym wymiarze czasu poprzez sprawdzenie samokontroli operatora oraz sprawdzenie i podpisanie odpowiedniego rejestru. Inspekcja w pełnym wymiarze czasu jest odpowiedzialna za kontrolę produktu gotowego i dokonywanie zapisów kontroli produktu końcowego.


    4) Przed sprzedażą
    Wynik testu można podać przed sprzedażą.
    Zewnętrzna instytucja wykrywająca jest dozwolona, ​​jeśli nie jesteś zadowolony z wyników testu.


    Nasze atuty:
    1. Jakość:
    Nasza firma od wielu lat zajmuje się profesjonalną produkcją półproduktów hormonalnych, nasze produkty eksportowane są do Niemiec, Hiszpanii, Wielkiej Brytanii, USA, Australii, Bliskiego Wschodu i innych krajów, a my mamy bardzo dobre opinie od naszych klientów, możesz Zaufaj nam.
    A my jesteśmy manufakturą, więc nie ma problemu z kontrolą jakości.
    2. Metoda płatności: , TT.
    3. Usługa: Najlepsza usługa z obsługą posprzedażną dla wszystkich klientów.
    4. Dostawa:
    Przykładowe zamówienie: Pakiet zostanie wysłany w ciągu 3 dni po dokonaniu płatności. Możemy wysłać go za pośrednictwem UP, EMS, HK Air Post, DHL lub w inny sposób. Posiadamy profesjonalną i stabilną logistykę, a paczkę możemy dostarczyć płynnie około 3 do 5 dni.


    Inny peptyd Dostarczamy do naszego laboratorium:

    Produkt Czystość Nr CAS
    Chlorowodorek glukagonu 98% 16941–32–5
    Octan gonadoreliny 98% 34973-08-5
    Octan gosereliny 98% 145781–92–6
    Octan GRF (ludzki) 98% 83930–13–6
    Octan heksareliny 98% 140703–51–1
    Octan Histreliny 98% 76712–82–8
    Octan ikatybanu 98% 30308–48–4
    Lanreotyd 98% 108736–35–2
    Octan Lecirelin (Dalmarelin) 98% 61012–19–9
    Leuprolid 98% 74381–53–6
    Octan leuproreliny 98% 53714–56–0
    Octan linaklotydu 98% 851199–59–2
    Liksisenatyd 98% 320367-13-3
    Lraglutyd 98% 204656-20-2
    Octan lizipresyny 98% 50–57–7
    Octan melanotanu II 98% 121062-08-6
    MOG (35–55) 98% 163913–87–9
    Octan Nafarelina 98% 76932–56–4
    Octan nesiritydu (BNP-32) 98% 114471–18–0
    Oktreotyd 98% 79517–01–4
    Octan ornipresyny 98% 3397–23–7
    Octan oksytocyny 98% 50–56–6
    Pentapeptyd palmitoilowy 98% 214047–00–4
    Peksiganan 98% 147664–63–9
    Octan pramlintydu 98% 196078–30–5
    Pretirelin
    Octan PT141 98% 32780–32–8
    Octan kalcytoniny z łososia 98% 47931–85–1
    Octan sekretiny 98% 10813–74–8
    Octan Sermoreliny 98% 86168–78–7
    Sincalide 98% 25126–32–3
    Octan Somatostatyny 98% 38916–34–6
    Octan Splenopentyny 98% 105184–37–0
    Octan taltireliny 98% 103300–74–9
    Octan teriparatidu 98% 52232–67–4
    Octan teriparatidu 98% 52232–67–4
    Octan terlipresyny 98% 14636-12-5
    Octan tetrakosaktydu 98% 16960–16–0
    Tymalfasin 98% 62304–98–7
    Tymopentyna 98% 69558–55–0
    Octan tymozyny α1 98% 14636-12-5
    Octan tymozyny β4 (TB-500) 98% 77591–33–4
    Octan triptoreliny 98% 57773–63–4
    Octan vapreotide 98% 103222–11–3
    Octan wazopresyny 98% 9034–50–8
    Octan cykonotydu 98% 107452–89–1

    Laboratorium

    Polityka klienta VIP:
    Jeśli Twoja Łączna kwota zakupów w naszej firmie może osiągnąć 50 000 USD, na koniec roku możemy użyć 2% -5% całkowitej kwoty do wysłania towarów bezpłatnych.

    Rodzaje klientów, którzy mieli większe wsparcie:
    1. Potencjalny klient
    (Przy zakupie danych + aktualny rynek klientów Liczba klientów i ilość produktów na miesiąc do zastosowania)

    2.Stabilna grupa klientów i stabilne zamówienie ilościowe na miesiąc
    (Z kompletnymi danymi dotyczącymi zakupów w naszej firmie, aby złożyć wniosek)

    3. Regularni użytkownicy indywidualni
    (Z kompletnymi danymi dotyczącymi zakupów w naszej firmie, aby złożyć wniosek)

    4. Klienci, którzy mają fundusze i planują rozszerzenie rynku
    (Przy zakupie danych + aktualny rynek klientów Liczba klientów i ilość produktów na miesiąc do zastosowania)
    ** Bieżące dane rzeczywiste + przyszły rynek (na podstawie bieżących)

    Szczegóły kontaktu
    Passion Technology Development Limited

    Osoba kontaktowa: Qin

    Wyślij zapytanie bezpośrednio do nas (0 / 3000)

    Inne produkty
    Poprosić o wycenę

    E-Mail | Mapa strony

    Privacy Policy Chiny dobry jakość Peptydy do wstrzykiwania dostawca. © 2018 - 2021 peptide-steroids.com. All Rights Reserved.